Вход на сайт

МЕДИАМЕТРИКА

Облако тегов

Абиогенез - самозарождение жизни

Аватар пользователя DarkUser

По рекомендации френда farfareast познакомился с одним из материалов движения "Брайтс"*, имеющим отношение к абиогенезу, а заодно и с самим  веб-сайтом этого движения. Я понимаю, что общие комментарии не слишком важны для оценки статьи, тем более, что написана оне не "брайтами", а австралийским фармакологом Ианом Масгрейвом (Ian Musgrave) **, и взята с известного западного атеистического ресурса, где была размещена еще в прошлом тысячелетии.

Замечу все же при этом, что движение, которое вроде бы находится в России, но использует для своего названия английское слово без перевода, а в качестве материалов переводит работы, написанные по большей части в Америке и обращенные к американской публике, производит впечатление заграничной франшизы вроде "Макдональдса" или "Баскин-Роббинса".***

Одаренные читатели подбрасывают монетки, чтобы убедиться в правоте Эрнста Геккеля и неправоте Фреда Хойла. Причем здесь Геккель и Хойл!? Смотрите ниже.
Brights


Статья, о которой пойдет речь, написана с целью объяснить общественности почему креационисты неправы, используя подсчеты вероятностей для доказательства невозможности самопроизвольного зарождения жизни (абиогенеза), и как это явление убедительно объясняется современной наукой. Первая задача автором в значительной части выполнена, хотя ход его аргументации мне кажется не самым удачным, а вторая – нет, что не удивительно, если судить по долгой уже истории усилий, предпринимаемых в этом направлении.

Увы, заметкая моя получилась очень объемистой, но подобные дискуссии, хотя бы и заочные, могут быть тольк конкретными, а конкретность требует объема. По этой причине, я разобью заметку на две части из соображений удобства. Тот, кто хочет прочитать их без перерыва может подождать второй части, которая последует через день или два.

Не вступая в обсуждение деталей всех возражений автора обсуждаемой статьи, я начну здесь с перечисления его основных пунктов. Причина этого проста – я заметил, что эти пять пунктов процитированные дословно нередко используются в качестве аргумента в дискуссии. В цитате «они» означают всевозможных креационистов, а также известного астрофизика покойного Фреда Хойла****; последнее не является проявлением сарказма, но взято мной из текста статьи.

Итак, приступим.
1) Они полагают вероятность формирования «современного» белка или даже целой бактерии со всеми «современными» белками результатом случайности. Хотя это — вовсе не теория абиогенеза.
2) Они предполагают, что существует установленное число необходимых для существования жизни белков с установленными для каждого белка последовательностями.
3) Они вычисляют вероятность не параллельных испытаний, а последовательных.
4) Они не понимают значения термина «вычисление вероятности».
5) Они сильно недооценивают число функциональных ферментов/рибозимов в группе произвольных последовательностей.
Я постараюсь последовательно разъяснить вам эти многочисленные ошибки и покажу, почему невозможно никаким значимым образом провести вычисление «вероятности абиогенеза».

(конец цитаты)

Пункт 4 является без сомнения оценочным утверждением и обобщением, поэтому мы его рассмотрим по мере знакомства с другими аргументами автора.

Пункт первый. Как и во всех прочих случаях, следует оставить за скобками «они полагают» как полемический ход и взглянуть на вторую часть. Действительно, учение о возникновении жизни основано на том, что этот процесс состоит из большого числа постепенных шагов, каждый из которых значительно проще и понятнее с точки зрения научного мировоззрения, чем мгновенное возникновение жизни из неживого. Мы еще вернемся к этому важному вопросу, но необходимо заметить, что даже для отдельных шагов процесса абиогенеза оценка их вероятности вполне оправдана. Поэтому аргумент не достигает своей цели.

Пункт второй. Здесь стоит согласиться с мыслью автора, хотя «они предполагают» тут совершенно излишнее. В своих заметках об исследованиях в области абиогенеза я об этом речь заводил. Когда люди пугают себя и слушателей вероятностями с огромным числом нулей после запятой, которые действительно очень малы, они должны понимать, вероятность чего именно столь пугающе мала. Например, если мы составляет белок длиной в сто аминокислотных остатков, перебирать все встречающиеся сегодня в организмах аминокислоты, то вероятность сложить правильную последовательность этого белка очень мала - приблизительно 1x10^-130, т.е. десять в степени минус 130, т.е. один шанс из 1000000…….00000000 (в этом числе 130 нулей). Вероятность выиграть в лотерею, в которой каждый житель Земли от мала до велика купил билет, составляет аж целых один шанс на 10^10, т.е. один на 10000000000, что в 10000….00000 (в этом числе 120 нулей) раз больше вероятности составить единственно возможную последовательность белка, о котором идет речь, случайным образом.

Но дело в том, что без всяких вольтерьянцев и брайтов мы знаем - функцию некоего белка могут вполне прилично выполнять его формы, в которых многие позиции заняты не какой-то одной определеннной аминокислотой, а несколькими или даже любой. В этом случае вероятность случайно составить функциональную последовательность гораздо выше. Тем более, если исходная форма такого белка была составлена не из ста аминокислотных «кирпичиков», а из пятидесяти или сорока.

Вот вам пример. Слева изображен инсулин, который здесь используется без какого-либо отношения к его настоящей функции. Он просто играет роль примера. Вероятность выбросить последовательность инсулина, бросая кости, 1 на 1х10^66 (т.е. один шанс на 10 в 66 степени). Но если белок сохраняет свою активность (возможно не полностью), когда аминокислотные остатки, перечеркнутые крест-накрест, могут быть любыми (не только теми, что изображены на картинке слева, а любыми), то вероятность увеличивается до 1 шанса на 1х10^53. Если те, что перечеркнуты одним мазком могут быть любыми, то она уже 1 на 1х10^36, а если и помеченные красной точной могут быть заменены, то вероятность возрастает до 1 на 1х10^27. Все еще невелика, но уже в 10000......000000 (39 нулей) раз выше исходной.

Human-Insulin-Protein-Structure-917x1024


Вторая часть аргумента похожа на первую. Если считать, что минимально необходимый для поддержания жизни клетки набор белков состоит из нескольких сотен белков, то можно получить вероятность образования всех этих белков с правильной последовательностью аминокислот перемножением вероятности, о которой шла речь выше, для каждого из этих белков. Таких белков, вероятно, насчитывается около 250; поэтому возводим 1/10130 в степень 250 и получаем (1/10130)250=1/1032500. Если хочется запугать себя посильнее (или наоборот успокоить, в зависимости от точки зрения), то желаемый размер белка следует увеличить (мы здесь исходим из длины в сто «кирпичиков-аминокислот», а ведь средний белок длиннее). Число нулей в знаменателе возрастет, а вероятность соответственно уменьшится.

Но заметим, что традиционное объяснение абиогенеза основано на постепенности изменений. Дело не только в том, что функция белка не требует наличия у него уникальной последовательности  и не только в том, что первичные белки постулируются короче современных, но и в том, что клетка с точки зрения учения о происхождении жизни естественным путем возникала «постепенно» и момента, когда должны были возникнуть все необходимые белки в готовом виде просто не существовало. Мы оставим обсуждение этого важного аспекта «на потом»; повторим только основной вывод – сверхмалые вероятности, которыми обычно аргументируют невозможность самопроизвольного возникновения жизни, строго говоря, не имеют отношения к вероятности ее возникновени. Они каждый раз относятся к некоему очень конкретному событию (например, что кости будут брошены таким образом, что выпадет именно последовательность человеческого цитохрома С), которое может иметь отношение к возникновению жизни, а может и не иметь. Используя эти вероятности для аргументации, следует все это понимать.

Пункт третий сформулирован неудачно, хотя и понятно. Людям, которые любят приводить сверхмалые вероятности в качестве аргумента, следует помнить, что по мнению геккелистов ***** Природа бросает кости не один раз, а много. Вычисляя вероятность возникновения «правильного» белка в т.н. первичном бульоне, следует учитывать, что в любой момент в этом бульоне существует огромное число разнообразных молекул белка и что их возникновение (и распад) происходит в течение длительного времени, увеличивая число комбинаций, которые возможно перебрать.

Важный инструмент во всех этих делах
dice[1]


Пятый пункт очень близок по сути пункту второму. Мы уже обсудили вопрос о том, что в основе вывода о сверхмалой вероятности образования белка, выполняющего определенную функцию, лежит предположение о том, что никакая другая последовательность аминокислотных «кирпичиков» не может этого делать. Это предположение неверно; очень многие позиции в последовательности белка не нуждаются в специфических аминокислотах, что значительно увеличивает обсуждаемую вероятность, хотя она по-прежнему остается малой.

То же самое можно сказать и о молекулах РНК, которые являются рибозимами, т.е.рибонуклеотидными энзимами, или, говоря совсем просто, которые могут ускорять химические реакции, как это делают ныне белковые ферменты (они же энзимы). Здесь стоит заметить, что РНК-энзимы выскакивают на сцену не просто так, а со значением. По целому ряду причин ученые, разрабатывающие учение об абиогенезе, посчитали, что объяснение этого процесса может быть проще, если предположить, что первые РНК занимались не только передачей биологической информации, что сегодня является их основной функцией, но и осуществляли многие функции современных белков, и воспроизводили себя, осуществляя, таким образом, и хранение информации. Такую гипотетическую примитивную жизнь на основе единственного типа макромолекул стали называть «миром РНК». В соответствии с этой идеей основанная изначально на РНК жизнь уже потом обзавелась другими биомакромолекулами, которые мы видим в клетках сегодня. Если вы совсем не знакомы с предметом, то предлагаю взглянуть на одну из частей моей заметки про абиогенез и Геккеля, в которой современные бункции белков, РНК и ДНК, а также т.н. мир РНК описаны аллюром “три креста” для тех, кто на уроках биологии в средней школе играл в футбол или разгадывал кроссворды.

Так вот, автор статьи на атеистическом сайте предупреждает любителей малых вероятностей, что для того, чтобы быть рибозимом, РНК не обязательно требуются уникальная последовательность нуклеотидных “кирпичиков”. Иными словами, в смеси молекул РНК, образованных в результате случайного перебора вариантов, окажется больше рибозимов, катализирующих некую химическую реакцию, чем мы ожидали, исходя из уникальности последовательности известного нам рибозима, катализирующего эту реакцию.

Я полностью согласен с автором в том, что обычно подобные расчеты позволяют нам лишь определить вероятность выпадения определенной комбинации костей. Отношение этих величин к проблеме самопроизвольного возникновения жизни не настолько прямое, как хотелось бы тем, кто любит использовать эти величины в качестве аргумента. Более того, адепты учения об абиогенезе стремятся использовать научный метод для демонстрации неслучайного характера процесса абиогенеза. В результате апелляция к малой вероятности образования уникальной последовательности белка/РНК не достигает цели в дискуссии со сциентистами (они как правило убеждены, что процесс в целом не является случайным), но вносит сумятицу в головы тех, кто принимает эти исчезающе малые величины, как убедительное доказательства бытия Божиего. Прошу понять меня правильно – вероятность образования «правильных» макромолекул действительно мала, но для использования подобного аргумента требуется понимание того, вероятность какого события мы оцениваем.

На этом согласие с автором закончилось. Теперь мы переходим к выражению решительного несогласия, обоснованной критике и откровенным, хотя и вежливым, насмешкам.

В своей статье Иан Масгрейв иллюстрирует непонимание креационистами учения о абиогенезе следующим рисунком.
Overall view


По мнению автора непонимающие считают, что клетка образуется в результате одного сверхмаловероятного события, но не таково учение, которого непонимающие не понимают. На самом деле, говорит автор, абиогенез представляет собой большое число небольших шагов, каждый из которых связан с небольшим усложнением организации, так что вещества, участвующие в этом процессе, медленно восходят к последней стадии абиогенеза, на которой появляется организм, а не совершают гигантский прыжок.

Автор в особенности замечает, что процесс формирования полимеров обусловлен химическими и физическими закономерностями, а отнюдь не случаен. О тех события, в которых случайность играет роль, т.е. появление «правильной» последовательности полимера, автор говорит, что они имеют вероятность гораздо бОльшую, чем приписывают этим событиям непонимающие; для того, чтобы полимер (белок или РНК) выполнял некую функцию, он не должен иметь уникальную последовательность – достаточно наличия в нем относительно небольшого числа правильных мономерных звеньев на ключевых позициях. Вероятность образования таких полимеров гораздо выше. Более того, автор призывает читателя не забывать о том, что природа совершает перебор не последовательно, старательно тряся стаканчиком с игральными костями, тихо нашептывая при этом тайные заклинания, а параллельно. Иначе говоря, в каждый отдельно взятый момент на первичной Земле существовало огромное количество молекул протобелка (прото-РНК) для выбора; поэтому малые частоты «правильных» последовательностей таких молекул компенсируются не только длительным временем перебора комбинаций, но и большим числом последних.

Такие объяснения полностью соответствую тому подходу, который я в длинной серии заметок на эту тему назвал геккельянством по имени известного естествоиспытателя 19 века Эрнста Геккеля.

Это Геккель
5_1[1]

А здесь вы найдете серию заметок о проблемах происхождения жизни, из которой вы поймете отчего я так ценю уникальный вклад Геккеля в прогресс прогрессизма: перваявторая,третьячетвераяпятая.

На вопрос о происхождении жизни геккельянство предлагает следующий глобальный ответ - очевидно, что жизнь существует, следовательно она как-то возникла; в этом случае она возникла самопроизвольно, поскольку ничего кроме материи в различных формах своего движения не существует. Этот ответ не может быть фальсифицирован (в терминологии К. Поппера, т.е. простыми словами – опровергнут) и следовательно не является научным и поэтому не нуждается в мелочных доказательствах. Тем не менее каждое поколение геккельянцев (или геккелистов), начиная с основателя учения, в течение 150 лет предлагает детализацию этого утверждения на языке современного этому поколению естествознания.

Сам Геккель формулировал свое объяснение так – первые организмы произошли не от организмов-предков, а в результате спонтанного появления из некоего раствора органических веществ, которые тоже возникли самопроизвольно. Хотя эти процессы никто никогда не наблюдал, «условия на примитивной Земле были иные... способствуя спонтанному образованию всего, что требовалось... и нет ничего невозможного для произведения белковых и иных необходимых для текущей теории тел синтетическим путем”. Это краткое объяснение из толстой и знаменитой книги Геккеля было достаточным для начитанного человека второй половины 19 века. Ни структура и состав клетки, ни структура и состав биомолекул не были ему известны, в то время как сам факт наличия у органических веществ сложных структур и принципиальной возможности эти структуры определить известен был. Более того, успехи синтетической химии, дающие жизнь таким полезным вещам, как анилиновые красители и бездымный порох, были для этого читателя очевидны. Поэтому идея о возможности синтеза “живой плазмы”, из которой могли образовываться организмы, звучала вполне обоснованно.

За полтора века, прошедшие с того времени, наука накопила значительное число новых гитик, сделавших необходимым перевод геккелевского объяснения самопроизвольного возникновения жизни на язык естествознания рубежа второго и третьего тысячелетий. Именно это и делает в своей статье Иан Масгрейв, не внося при этом радикальных изменений в объяснение, некогда сформулированное Геккелем.

В общем, автор убеждает читателя, что по отдельности все шаги процесса абиогенеза нам достаточно хорошо понятны; процессу достаточно пройти все эти ступени на что у него есть сотни миллионов лет. На самом деле, пошаговая разбивка процесса демонстрирует нечто иное, а именно то, что абиогенез состоит не из одного, а из многих маловероятных событий.

Так, упрощенная схема из обсуждаемой статьи начинается с простых веществ, из которых образуются полимеры. Образование таких «простых веществ» представлено как проблема вполне решенная. Так положено думать всем школьникам, которые видят в учебнике фотографию знаменитого прибора Юри и Миллера, похожего на самогонный аппарат.

И правда похож
SMiller


Однако дело обстоит совсем не так просто. В ставшем классическим эксперименте Юри и Миллера и большом числе похожих экспериментов было показано, что в некоторых условиях вещества, являющиеся «кирпичиками» биополимеров действительно образуются. Но большинство из тех, что образуются, присутствуют в смеси продуктов в очень малых количествах. Но образование некоторых так и не было показано в модельных экспериментах. Но условия, в которых их образование должно было происходить и в которых мы должны моделировать этот процесс, нам неизвестны. Но при всем этом вопрос объявлен решенным.

Так же выглядит и вторая ступенька – “полимеры”. Действительно ли это “малый шаг” и “небольшое увеличение сложности”, как пишет автор? Действительно ли их образование обусловлено химическими и физическими закономерностями? Обусловлено, несомненно. Но обусловленность эта не так оптимистична для учения о самопроизвольном происхождении жизни. Один из основных видов биополимеров или биомакромолекул, если вы привыкли к такому термину, это белки. Они состоят из аминокислот, связанных в длинную цепочку. Но из аминокислот белок (или короткая цепочка аминокислот, называемая обычно пептидом) образоваться в водном растворе практически не может.

Дело в том, что у реакции соединения аминокислот с образованием пептида и виды есть обратная реакция – расщепления пептида на аминокислоты с использованием воды (гидролиз). Образование пептидной связи идет с затратой химической энергии, а распад энергетически выгоден, он идет самопроизвольно. Равновесие этих реакций в воде сильно сдвинуто в сторону гидролиза, распада пептида и образования свободных аминокислот. То же самое наблюдается и для нуклеиновых кислот - ДНК и РНК.

В клетке белки и нуклеиновые кислоты образуются не непосредственно из своих «кирпичиков», а из их активированных форм. Поэтому практически любое обсуждение процесса предбиологического образования полимеров включает идею о том, как сделать «кирпичики» активированными. В реальной клетке это происходит с участием т.н. высокоэнергетических фосфатов, источником которых является АТФ, которая образуется, говоря кратко, в результате сложных процессов обмена веществ. В моделях, предлагаемых адептами абиогенеза, источником энергии выступают, как правило, другие вещества. Но так или иначе, их образование – дело совсем непростое; в водной среде баланс образования и распада «высокоэнергети-ческих» связей в АТФ и похожих на него соединениях сильно смещен в сторону распада. Поэтому теоретические и немногие экспериментальные модели образования биополимеров нередко исходят из того, что полимеры эти образовывались в безводной среде, и уже потом попадали в воду, где и осуществляли свои функции. Но такие объяснения никогда не являются простыми (см. ниже).

Здесь уместно снова поговорить о вероятностях. Хотя происхождение полимеров в условиях предбиологической Земли никак не могло быть простым процессом, в чем нас хочет убедить Иан Масгрейв, главная проблема состоит не в том, чтобы объяснить их синтез вообще, но синтез матричный. В современной клетке последовательности белков и нуклеиновых кислот не случайны, но закодированы в структуре генов (т.е. последовательности кирпичиков ДНК), а процессы их синтеза представляют не что иное как перевод генетической информации в последовательность аминокислотных «кирпичиков» в белках. В одной из частей длинного поста о проблемах объяснения спонтанного возникновения жизни я привел серию простых картинок, иллюстрирующих эти процессы.

Вот такая, например, которая схематически показывает, как генетическая информация "переводится" в структуру белка.
figurea6

Или вот такая
TransTranscrip


По этой причине возникновение биополимера, способного к самовоспроизведению (саморепликации), привлекает немалое внимание адептов учения об абиогенезе. Немало экспериментов было проведено, чтобы показать возможность предбиологической репликации, но все они содержали серьезные изъяны.

Иан Масгрейв в своей статье упоминает несколько таких экспериментов, особенно детально разбирая один пример, на который взглянем и мы. В качестве модели автор выбрал 32-членный пептид, якобы способный самореплицироваться, соединяя два пептида с последовательностями, соответствующими половинкам. Вероятность того, что в ходе бросков игральных костей выпадет последовательность «саморепликатора» очень мала - один шанс на 4x10^40. Это вовсе не страшно, говорит автор. И затем начинает показательный сеанс одновременной игры на 160 досках, убедительно демонстрируя свою правоту. Но заметим, что это даже не печально известный сеанс шахматной игры в Васюках, а банальная игра в наперсток. Поэтому внимательно следите за руками.

Я позволю себе привести длинную цитату из обсуждаемой статьи, помечу места, где происходить кидалово и объясню почему и как читателя кидают. После этого мы попытаемся произвести те же самые расчеты без трюков.

Итак продолжаем цитирование.
Теперь поиграем в креационистскую игру — рассмотрим формирование пептида путем случайного добавления аминокислот. Естественно, на ранней Земле пептиды возникли совершенно не так, но данное допущение будет показательным.

В качестве примера я использую «самовоспроизводящийся» пептид из вышеупомянутой группы Гадири [7]. Можно было бы взять другие примеры, такие как самореплицирующийся гексануклеотид [10], саморепликатор SunY [24] или РНК-полимераза, описанные группой Экланда (Eckland)****** [12], но для иллюстрации точки зрения креационистов в рамках соблюдения исторической непрерывности — небольшой пептид идеален. Длина этого пептида — 32 аминокислоты с последовательностью RMKQLEEKVYELLSKVACLEYEVARLKKVGE, являющейся также ферментом — пептидной лигазой — воспроизводящим самого себя из двух субъединиц длиною по 16 аминокислот. Кроме того, размером и составом пептидная лигаза идеально подходит для рождения путем абиотического синтеза пептидов. Тот факт, что она — саморепликатор, придает процессу дополнительной ироничности.

(конец цитаты)

Автор немного путается в ссылках – цитировать тут следует не ссылку [7], а ссылку [17] из списка литературы в его статье. Соединяются не два пептида по 16 звеньев, а один 15-членный и второй 17-членный. Но это все мелочи.

Первое обстоятельство, о котором вам не сообщают заключается в том, что этот пептид ускоряет реакцию соединения двух пептидов, соответствующих частям последовательности «саморепликатора», раза в два-три. Гораздо более эффективной является катализ, описанный в ссылке [7], поэтому она и была, наверное, процитирована вместо ссылки [17], но там нет собственно “саморепликации”. Но это не самое важное обстоятельство. Важнее то, что эти пептиды соединяются в экспериментах, описанных в [7] и [17], и без пептидной лигазы - «саморепликатора», что звучит странно, поскольку я выше заявил, что пептидные связи самопроизвольно в воде не образуются.

Они и не образуются, но в данной работе один из соединяющихся в реакции пептидов «активирован» путем добавления в реакцию бензилмеркаптана, об образовании которого в модельных условиях предбиологической Земли мне не известно. (Пусть адепты учения или просто знающие люди мне подскажут, если я неправ.) Без добавления бензилмеркаптана, необходимого для активации, эта реакция не пойдет. Более того, эта реакция нуждается не только в активации одного из соединяющихся пептидных концов, но и в наличии серосодержащей аминокислоты цистеина на другом вступающем в реакцию пептидном конце, так что не всякие два пептида могут быть соединены даже в присутствии бензилмеркаптана.

Что же делает пептид - «саморепликатор»? Он ускоряет эту реакцию, образуя комплекс с пептидами, в нее вступающими, таким образом ориентируя их в подходящем для реакции положении. Так, действительно, и действуют ферменты, но ни они, ни «саморепликатор», не заставят соединиться пептиды, если этот процесс энергетически невыгоден. В данном конкретном случае, т.н. саморепликатор ускоряет реакцию, которая идет только благодаря наличию бензилмеркаптана и подходящей структуре вступающих в реакцию пептидов. На этом можно было бы закончить обсуждение, поскольку оказывается, что саморепликатор таковым вовсе не является: он не может активировать аминокислоты для того, чтобы они могли соединяться в пептидные цепочки, и вообще не может строить свою копию из аминокислот, но только из двух довольно длинных пептидов, представляющих собой копии половинок репликатора, которые должны быть синтезированы заранее, активированы и предъявлены «саморепликатору».

Вот так схематично выглядит работа "саморепликатора".
Peptide ligase 2


Тем не менее мы продолжим анализ аргументации Масгрейва. В ней есть еще много интересного. Например, рассказывая о «саморепликаторе», автор обходит вниманием еще одно немаловажное обстоятельство, к которому мы вернемся позднее.

Продолжаем цитату из статьи на сайте движения одаренных.
Вероятность её возникновения при последовательных случайных попытках равна (1/20)^32, или одному шансу из 4,29х10^40. Это во много-много раз вероятнее одного шанса из 2,04х10^390, предлагаемого стандартным креационистским сценарием «случайного возникновения карбоксипептидазы», но всё-таки ещё очень маловероятно.

Тем не менее, есть и иной аспект оценки этих вероятностей, заключающийся в том, что большинство из нас не вполне понимает статистику. Когда нам говорят, что некое событие имеет один шанс на миллион, многие думают, что для его выпадения нужен миллион попыток, но это не так.

Следующий эксперимент вы можете проделать сами: возьмите монетку, подбросьте её четыре раза, запишите результаты и повторите всё снова. Сколько, по-вашему, раз придется повторить процедуру, прежде чем вы получите четыре орла подряд?

Вероятность выпадения четырех орлов подряд равна (1/2)^4, или одному шансу из 16. Значит ли это, что прежде, чем получить четырех орлов (ОООО), мы сделаем 16 попыток? Нет: в последовательных экспериментах я проделал 11, 10, 6, 16, 1, 5 и 3 попытки прежде, чем получил ОООО. Цифра 1/16 (или 1 на миллион, или 1 на 10^40) описывает вероятность события в отдельно взятой попытке, но не описывает того, как процесс будет развиваться в серии. Можно выбросить ОООО с первой же попытки (у меня получалось). Даже при одном шансе из 4,29х10^40 саморепликатор может зародиться очень быстро. Но это ещё не всё.

Один шанс из 4,29х10^40 — это всё равно ужасно, просто чрезвычайно маловероятно; это число трудно даже представить. Даже с учётом вышеприведенного аргумента (о том, что можно получить желаемое с первой попытки), многие скажут: «так или иначе, чтобы случайными методами получить этот репликатор, потребуется больше времени, чем существует Земля». На самом деле, нет; ведь в приведённых выше примерах мы рассматривали последовательные попытки как если бы за каждую попытку собирался только один белок/ДНК/проторепликатор. А в действительности, в процессе взаимодействия миллиардов молекул элементарных компонентов в океанах или на тысячекилометровых береговых линиях, могущих предоставить каталитические поверхности или матрицы [2,15], одновременно осуществлялись миллиарды попыток.

Давайте вернёмся к нашему примеру с монетками. Допустим, подбрасывание монетки 4 раза займёт не больше минуты; чтобы выпало ОООО, в среднем потребуется 8 минут. Теперь позовите 16 друзей, каждому дайте монету, и пусть одновременно подбросят монетки 4 раза подряд; теперь среднее время получения ОООО составит 1 минуту; теперь попробуйте выбросить 6 орлов подряд; Вероятность этого — (1/2)^6, или 1 из 64. Это заняло бы в среднем полчаса, но найдите в помощь 64 человек — и получите нужный результат за минуту. Если хотите получить последовательность, имеющую вероятность 1 к миллиарду, попросите население Китая подкидывать для вас монетки и получите комбинацию в кратчайшие сроки.

Таким образом, если на нашей пребиотической Земле одновременно появлялись миллиарды пептидов, то предполагаемое время, необходимое для создания нашего репликатора, существенно сокращается.

Хорошо, теперь снова посмотрите на число 1 из 4,29×10^40, это большое число, и хотя миллиард исходных молекул — много, можно ли в принципе получить достаточно молекул, чтобы случайно собрать первый репликатор менее чем за полмиллиарда лет?

Да, один килограмм аминокислоты аргинина содержит 2,85×10^24 молекул (это гораздо больше миллиарда миллиардов); тонна аргинина содержит 2,85×10^27 молекул. Если вы возьмете нагруженный всеми нужными аминокислотами грузовик и сбросите его в озеро среднего размера, этих молекул будет достаточно, чтобы в течение нескольких десятков лет получить наш репликатор, учитывая, что белки длиною 55 аминокислот создаются за одну-две недели [14,16].

(конец цитаты)

Простите за длинную цитату, но не пересказывать же все это своими словами. Здесь все в целом правильно, о чем мы уже и говорили. Действительно, шанс выбросить с помощью игральных костей последовательность пептида, который автор называет саморепликатором, гораздо выше, чем шанс выбросить последовательность белка длиной в 100 аминокислотных остатков. Действительно, чем больше число людей (или обезьян), бросающих кости в этом примере, тем вероятнее короче время, которое потребуется для выпадения правильной последовательности. Но кости и игроки, их бросающие, просто дают нам наглядный пример. На самом деле, мы должны были бы посчитать сколько пептидных цепей образуется за единицу времени на Земле, а затем, зная каков среди них процент «правильных» последовательностей, вычислить число образующихся за это время «саморепликаторов». Во второй части будет описано, как автор пытается это сделать. (Не забываем следить за руками!)

Этот кот (очень похож на моего, но по внешности только) не позволяет обмануть себя при игре в наперсток. Но не все так талантливы. 



* Слово bright как существительное может означать “яркий/кричащий цвет, светильник, фара” и используется нечасто. Обычно это слово используют в качестве прилагательного и тут оно может означать не только «яркий, сверкающий», но и «умный, одаренный». Так что это слово можно перевести как «умники», но с очевидной аллюзией к «Просвещению» и даже «иллюминатам», а там и к самому Деннице/Светоносцу.

** Судя по университетскому веб-сайту и библиографическим указателям, Иан Масгрейв работает в Университете Аделаиды и является специалистом по фармакологии и токсикологии. Его наукометрические показатели ничем не выделяются среди таковых для сотен тысяч научных сотрудников, работающих в области биологических наук. Пишу об этом не для того, чтобы очернить автора обсуждаемой статьи, а чтобы предотвратить возможность неверного понимания сложившейся обстановки.

*** Даже картинка, предваряющая эту статью, политкорректно показывает подбрасывающих монетки (речь ведь идет о вероятности) «детей разных народов», преимущественно азиатов. Такая концентрация последних даже для США выглядит нарочито. Не исключено, что российские брайты нашли готовую картинку на сайте корейского или сингапурского отделения люциферистов.

**** Я был удивлен тем, как автор запросто называет Ф. Хойла по имени – Фредом. Об их старинной дружбе мне ничего не известно, поэтому такая ничем не спровоцированная фамильярность поражает. Тем более, что она исходила от австралийца, который как лояльный колониальный подданный британской короны мог бы с полным правом назвать известного астрофизика и члена Королевского Общества сэром Фредом.

***** Вам просто необходимо пробежать мои давешние заметки о проблеме самопроизвольного возникновения жизни, чтобы понять отчего обсуждая эти вопросы я постоянно обращаюсь к наследию известного любимца Ильича.

****** На самом деле Ekland.



Продолжение последует через день, после Благовещения.

Автор: Партизан-1812

Источник

Фонд поддержки авторов AfterShock

Комментарии

Аватар пользователя Т55М
Т55М(2 года 11 месяцев)(10:53:56 / 06-04-2016)

Ричард Доккинз  Слепой часовщик , глава "Истоки и чудеса" /наверное, лучшее произведение по популяризации биологии на сегодняшний момент/

Забрал статью к себе в блог.

 

Аватар пользователя Лебядкин
Лебядкин(1 год 8 месяцев)(12:12:43 / 06-04-2016)

Панический невроз (боязнь) оказаться винтиком опрокидываеться на реальность так, что мыслитель не может позволить себе даже задуматься над тем , что все индивиды живого являют собой связанную целокупность — в итоге принимают на вооружение гипотезы создания «одиночно-видового».

Должен быть гвоздь, на котором держится вся эта мельница, построенная без единого гвоздя.

ЗЫ Попробую кларифицировать для вящей пучности. Вполне возможно создание отдельного вида бактерии — даже с упрощённым набором команд, но невозможно ожидать результатов, кроме как — среда уничтожает бактерию — или — бактерия уничтожает среду.

Ещё раз — в творении (или в воссоздании) возможно только творение целокупного, где индивиды являются только частями одного целого — иначе

Аватар пользователя vitenok
vitenok(2 года 11 месяцев)(14:50:45 / 06-04-2016)

Мне кажется, к науке это не имеет никакого отношения. Это скорее всего вопрос веры. Одни верят в создателя, другие верят в случайность. Доказывают примерно одинаковым набором доказательств. Ничего нельзя доказать, и проверить экспериментом. А значит - все это за скобками научного знания. 

Аватар пользователя by@huk
by@huk(2 года 2 месяца)(12:01:57 / 08-04-2016)

дак что, всё-таки эволюция?

Лидеры обсуждений

за 4 часаза суткиза неделю

Лидеры просмотров

за неделюза месяцза год

СМИ

Загрузка...